Lineage for d1qoja_ (1qoj A:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 149219Fold a.2: Long alpha-hairpin [46556] (11 superfamilies)
  4. 149297Superfamily a.2.9: C-terminal UvrC-binding domain of UvrB [46600] (1 family) (S)
  5. 149298Family a.2.9.1: C-terminal UvrC-binding domain of UvrB [46601] (1 protein)
  6. 149299Protein C-terminal UvrC-binding domain of UvrB [46602] (1 species)
  7. 149300Species Escherichia coli [TaxId:562] [46603] (2 PDB entries)
  8. 149303Domain d1qoja_: 1qoj A: [15716]

Details for d1qoja_

PDB Entry: 1qoj (more details), 3 Å

PDB Description: crystal structure of e.coli uvrb c-terminal domain, and a model for uvrb-uvrc interaction.

SCOP Domain Sequences for d1qoja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qoja_ a.2.9.1 (A:) C-terminal UvrC-binding domain of UvrB {Escherichia coli}
spkalqqkiheleglmmqhaqnlefeeaaqirdqlhqlrelfiaas

SCOP Domain Coordinates for d1qoja_:

Click to download the PDB-style file with coordinates for d1qoja_.
(The format of our PDB-style files is described here.)

Timeline for d1qoja_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1qojb_