SCOPe 2.08: Domain d1qoja_: 1qoj A:

Lineage for d1qoja_ (1qoj A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.9: C-terminal UvrC-binding domain of UvrB [46600] (1 family)

5. Family a.2.9.1: C-terminal UvrC-binding domain of UvrB [46601] (1 protein)

6. Protein C-terminal UvrC-binding domain of UvrB [46602] (1 species)

7. Species Escherichia coli [TaxId:562] [46603] (2 PDB entries)

8. Domain d1qoja_: 1qoj A: [15716]

Details for d1qoja_

PDB Entry: 1qoj, 3 Å

PDB Description: crystal structure of e.coli uvrb c-terminal domain, and a model for uvrb-uvrc interaction.

PDB Compounds: (A:) uvrb

SCOPe Domain Sequences for d1qoja_:

Sequence; same for both SEQRES and ATOM records:

>d1qoja_ a.2.9.1 (A:) C-terminal UvrC-binding domain of UvrB {Escherichia coli [TaxId: 562]}
spkalqqkiheleglmmqhaqnlefeeaaqirdqlhqlrelfiaas

Timeline for d1qoja_:

• d1qoja_ first appeared (with stable ids) in SCOP 1.55
  
• d1qoja_ appears in SCOPe 2.07