SCOP 1.75: Domain d3czya1: 3czy A:10-223

Lineage for d3czya1 (3czy A:10-223)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (4 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (3 proteins)

6. Protein Heme oxygenase-1 (HO-1) [48615] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48616] (20 PDB entries)
   Uniprot P09601

8. Domain d3czya1: 3czy A:10-223 [157159]
   automatically matched to d1ni6c_
   complexed with ad8, hem

Details for d3czya1

PDB Entry: 3czy, 1.54 Å

PDB Description: Crystal Structure of Human Heme Oxygenase-1 in Complex with 1-(Adamantan-1-yl)-2-(1H-imidazol-1-yl)ethanone

PDB Compounds: (A:) Heme oxygenase 1

SCOP Domain Sequences for d3czya1:

Sequence; same for both SEQRES and ATOM records:

>d3czya1 a.132.1.1 (A:10-223) Heme oxygenase-1 (HO-1) {Human (Homo sapiens) [TaxId: 9606]}
pqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiernk
espvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepell
vahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyrsrmnsl
emtpavrqrvieeaktafllniqlfeelqellth

Timeline for d3czya1:

• d3czya1 is new in SCOP 1.75
  
• d3czya1 is called d3czya_ in SCOPe 2.01
  
• d3czya1 appears in the current release, SCOPe 2.08, called d3czya_