Lineage for d3czhb1 (3czh B:40-501)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005422Protein Vitamin D 25-hydroxylase Cyp2R1 [158749] (1 species)
  7. 2005423Species Human (Homo sapiens) [TaxId:9606] [158750] (4 PDB entries)
    Uniprot Q6VVX0 39-501
  8. 2005425Domain d3czhb1: 3czh B:40-501 [157150]
    Other proteins in same PDB: d3czha2, d3czhb2
    automatically matched to 3C6G A:40-502
    complexed with bcd, d2v, hem, unx

Details for d3czhb1

PDB Entry: 3czh (more details), 2.3 Å

PDB Description: crystal structure of cyp2r1 in complex with vitamin d2
PDB Compounds: (B:) Cytochrome P450 2R1

SCOPe Domain Sequences for d3czhb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3czhb1 a.104.1.1 (B:40-501) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]}
ppgppglpfigniyslaasselphvymrkqsqvygeifsldlggistvvlngydvvkecl
vhqseifadrpclplfmkmtkmggllnsrygrgwvdhrrlavnsfryfgygqksfeskil
eetkffndaietykgrpfdfkqlitnavsnitnliifgerftyedtdfqhmielfsenve
laasasvflynafpwigilpfgkhqqlfrnaavvydflsrliekasvnrkpqlpqhfvda
yldemdqgkndpsstfskenlifsvgeliiagtetttnvlrwailfmalypniqgqvqke
idlimgpngkpswddkckmpyteavlhevlrfcnivplgifhatsedavvrgysipkgtt
vitnlysvhfdekywrdpevfhperfldssgyfakkealvpfslgrrhclgehlarmemf
lfftallqrfhlhfphelvpdlkprlgmtlqpqpylicaerr

SCOPe Domain Coordinates for d3czhb1:

Click to download the PDB-style file with coordinates for d3czhb1.
(The format of our PDB-style files is described here.)

Timeline for d3czhb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3czhb2