SCOPe 2.07: Domain d3cyoa_: 3cyo A:

Lineage for d3cyoa_ (3cyo A:)

1. Root: SCOPe 2.07

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.2: Virus ectodomain [58069] (2 families)

5. Family h.3.2.1: Virus ectodomain [58070] (9 proteins)

6. Protein Retrovius gp41 protease-resistant core [58071] (4 species)
   coiled coil; biological unit: trimer

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [58072] (26 PDB entries)

8. Domain d3cyoa_: 3cyo A: [157147]
   automated match to d3cyoa1
   mutant

Details for d3cyoa_

PDB Entry: 3cyo, 2.1 Å

PDB Description: structure of a longer thermalstable core domain of hiv-1 gp41 containing the enfuvirtide resistance mutation n43d and complementary mutation e137k

PDB Compounds: (A:) Transmembrane Protein

SCOPe Domain Sequences for d3cyoa_:

Sequence, based on SEQRES records:

>d3cyoa_ h.3.2.1 (A:) Retrovius gp41 protease-resistant core {Human immunodeficiency virus type 1 [TaxId: 11676]}
tvqarqllsgivqqqndllraieaqqhllqltvwgikqlqarsggrggwmewdreinnyt
slihslieksqnqqekneqelle

Sequence, based on observed residues (ATOM records):

>d3cyoa_ h.3.2.1 (A:) Retrovius gp41 protease-resistant core {Human immunodeficiency virus type 1 [TaxId: 11676]}
tvqarqllsgivqqqndllraieaqqhllqltvwgikqlmewdreinnytslihslieks
qnqqekneqelle

Timeline for d3cyoa_:

• d3cyoa_ first appeared in SCOP 1.75, called d3cyoa1
  
• d3cyoa_ appears in SCOPe 2.06
  
• d3cyoa_ appears in the current release, SCOPe 2.08