Lineage for d3cykc1 (3cyk C:10-124)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 790366Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 790527Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (1 family) (S)
  5. 790528Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (1 protein)
  6. 790529Protein Transthyretin (synonym: prealbumin) [49474] (4 species)
    sandwich; 8 strands in 2 sheets
  7. 790550Species Human (Homo sapiens) [TaxId:9606] [49475] (79 PDB entries)
    Uniprot P02766 31-143
  8. 790571Domain d3cykc1: 3cyk C:10-124 [157145]
    automatically matched to d1gkoa_
    complexed with act, gol, zn; mutant

Details for d3cykc1

PDB Entry: 3cyk (more details), 1.38 Å

PDB Description: Crystal structure of the F87M/L110M mutant of human transthyretin at pH 4.6.
PDB Compounds: (C:) Transthyretin

SCOP Domain Sequences for d3cykc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cykc1 b.3.4.1 (C:10-124) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispmhehaevvftandsgprrytiaamlspysysttavvtn

SCOP Domain Coordinates for d3cykc1:

Click to download the PDB-style file with coordinates for d3cykc1.
(The format of our PDB-style files is described here.)

Timeline for d3cykc1:

  • d3cykc1 is new in SCOP 1.75
  • d3cykc1 does not appear in SCOPe 2.01