SCOPe 2.06: Domain d1eiya1: 1eiy A:6-84

Lineage for d1eiya1 (1eiy A:6-84)

Root: SCOPe 2.06
Class a: All alpha proteins [46456] (289 folds)
Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
2 helices; antiparallel hairpin, left-handed twist
Superfamily a.2.7: tRNA-binding arm [46589] (5 families)
formerly a class II aminoacyl-tRNA synthetase N-domain
Family a.2.7.2: Phenylalanyl-tRNA synthetase (PheRS) [46593] (1 protein)
automatically mapped to Pfam PF02912
Protein Phenylalanyl-tRNA synthetase (PheRS) [46594] (1 species)
Species Thermus thermophilus [TaxId:274] [46595] (2 PDB entries)
Domain d1eiya1: 1eiy A:6-84 [15714]
Other proteins in same PDB: d1eiya2, d1eiyb1, d1eiyb2, d1eiyb3, d1eiyb4, d1eiyb5, d1eiyb6
protein/RNA complex

Details for d1eiya1

PDB Entry: 1eiy (more details), 3.3 Å

PDB Description: the crystal structure of phenylalanyl-trna synthetase from thermus thermophilus complexed with cognate trnaphe

PDB Compounds: (A:) phenylalanyl-tRNA synthetase

SCOPe Domain Sequences for d1eiya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eiya1 a.2.7.2 (A:6-84) Phenylalanyl-tRNA synthetase (PheRS) {Thermus thermophilus [TaxId: 274]}
laaiqnardleelkalkarylgkkglltqemkglsalpleerrkrgqelnaikaaleaal
earekaleeaalkealere

SCOPe Domain Coordinates for d1eiya1:

Click to download the PDB-style file with coordinates for d1eiya1.
(The format of our PDB-style files is described here.)

Timeline for d1eiya1: