| Class a: All alpha proteins [46456] (285 folds) |
| Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.7: tRNA-binding arm [46589] (5 families) ![]() formerly a class II aminoacyl-tRNA synthetase N-domain |
| Family a.2.7.2: Phenylalanyl-tRNA synthetase (PheRS) [46593] (1 protein) automatically mapped to Pfam PF02912 |
| Protein Phenylalanyl-tRNA synthetase (PheRS) [46594] (1 species) |
| Species Thermus thermophilus [TaxId:274] [46595] (2 PDB entries) |
| Domain d1eiya1: 1eiy A:6-84 [15714] Other proteins in same PDB: d1eiya2, d1eiyb1, d1eiyb2, d1eiyb3, d1eiyb4, d1eiyb5, d1eiyb6 protein/RNA complex |
PDB Entry: 1eiy (more details), 3.3 Å
SCOPe Domain Sequences for d1eiya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eiya1 a.2.7.2 (A:6-84) Phenylalanyl-tRNA synthetase (PheRS) {Thermus thermophilus [TaxId: 274]}
laaiqnardleelkalkarylgkkglltqemkglsalpleerrkrgqelnaikaaleaal
earekaleeaalkealere
Timeline for d1eiya1: