Lineage for d1eiya1 (1eiy A:6-84)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.2: Long alpha-hairpin [46556] (11 superfamilies) 
Superfamily a.2.7: A class II aminoacyl-tRNA synthetase N-domain [46589] (2 families) 
- Family a.2.7.2: Phenylalanyl-tRNA synthetase (PheRS) [46593] (1 protein)
- Protein Phenylalanyl-tRNA synthetase (PheRS) [46594] (1 species)
- Species Thermus thermophilus [TaxId:274] [46595] (1 PDB entry)
- Domain d1eiya1: 1eiy A:6-84 [15714]
Other proteins in same PDB: d1eiya2, d1eiyb1, d1eiyb2, d1eiyb3, d1eiyb4, d1eiyb5, d1eiyb6
Details for d1eiya1
PDB Entry: 1eiy (more details), 3.3 Å
PDB Description: the crystal structure of phenylalanyl-trna synthetase from thermus thermophilus complexed with cognate trnaphe
SCOP Domain Sequences for d1eiya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eiya1 a.2.7.2 (A:6-84) Phenylalanyl-tRNA synthetase (PheRS) {Thermus thermophilus}
laaiqnardleelkalkarylgkkglltqemkglsalpleerrkrgqelnaikaaleaal
earekaleeaalkealere
SCOP Domain Coordinates for d1eiya1 are not available.
Timeline for d1eiya1:
- d1eiya1 appears in SCOP 1.57
- d1eiya1 appears in the current release, SCOPe 2.08