Lineage for d3cxht_ (3cxh T:)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1957421Fold f.23: Single transmembrane helix [81407] (40 superfamilies)
    not a true fold
  4. 1958207Superfamily f.23.14: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family) (S)
    automatically mapped to Pfam PF05365
  5. 1958208Family f.23.14.1: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (2 proteins)
  6. 1958243Protein automated matches [190326] (3 species)
    not a true protein
  7. 1958246Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [187308] (3 PDB entries)
  8. 1958250Domain d3cxht_: 3cxh T: [157138]
    Other proteins in same PDB: d3cxha1, d3cxha2, d3cxhb1, d3cxhb2, d3cxhc1, d3cxhc2, d3cxhd1, d3cxhd2, d3cxhe1, d3cxhe2, d3cxhf_, d3cxhg_, d3cxhh_, d3cxhj_, d3cxhk_, d3cxhl1, d3cxhl2, d3cxhm1, d3cxhm2, d3cxhn1, d3cxhn2, d3cxho1, d3cxho2, d3cxhp1, d3cxhp2, d3cxhq_, d3cxhr_, d3cxhs_, d3cxhu_, d3cxhv_, d3cxhw_
    automated match to d1ezvi_
    complexed with 6ph, 7ph, 8pe, 9pe, cn6, fes, hem, sma, suc, umq

Details for d3cxht_

PDB Entry: 3cxh (more details), 2.5 Å

PDB Description: structure of yeast complex iii with isoform-2 cytochrome c bound and definition of a minimal core interface for electron transfer.
PDB Compounds: (T:) Cytochrome b-c1 complex subunit 9

SCOPe Domain Sequences for d3cxht_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cxht_ f.23.14.1 (T:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
sslyktffkrnavfvgtifagafvfqtvfdtaitswyenhnkgklwkdvkariaa

SCOPe Domain Coordinates for d3cxht_:

Click to download the PDB-style file with coordinates for d3cxht_.
(The format of our PDB-style files is described here.)

Timeline for d3cxht_: