SCOPe 2.07: Domain d3cxhq_: 3cxh Q:

Lineage for d3cxhq_ (3cxh Q:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.28: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81532] (1 superfamily)
   membrane-associated alpha-helical protein; no transmembrane helices

4. Superfamily f.28.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81531] (1 family)
   location - intermembrane side of the bc1 complex
   automatically mapped to Pfam PF02320

5. Family f.28.1.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81530] (2 proteins)
   "acidic/hinge protein", essential for the complex formation, interacts with the functional domain of cytochrome c1

6. Protein automated matches [190042] (4 species)
   not a true protein

7. Species Saccharomyces cerevisiae [TaxId:764097] [255784] (2 PDB entries)

8. Domain d3cxhq_: 3cxh Q: [157135]
   Other proteins in same PDB: d3cxha1, d3cxha2, d3cxhb1, d3cxhb2, d3cxhc1, d3cxhc2, d3cxhd1, d3cxhd2, d3cxhe1, d3cxhe2, d3cxhg_, d3cxhh_, d3cxhi_, d3cxhj_, d3cxhk_, d3cxhl1, d3cxhl2, d3cxhm1, d3cxhm2, d3cxhn1, d3cxhn2, d3cxho1, d3cxho2, d3cxhp1, d3cxhp2, d3cxhr_, d3cxhs_, d3cxht_, d3cxhu_, d3cxhv_, d3cxhw_
   automated match to d1kb9f_
   complexed with 6ph, 7ph, 8pe, 9pe, cn6, fes, hem, sma, suc, umq

Details for d3cxhq_

PDB Entry: 3cxh, 2.5 Å

PDB Description: structure of yeast complex iii with isoform-2 cytochrome c bound and definition of a minimal core interface for electron transfer.

PDB Compounds: (Q:) Cytochrome b-c1 complex subunit 6

SCOPe Domain Sequences for d3cxhq_:

Sequence; same for both SEQRES and ATOM records:

>d3cxhq_ f.28.1.1 (Q:) automated matches {Saccharomyces cerevisiae [TaxId: 764097]}
vtdqledlrehfknteegkalvhhyeecaervkiqqqqpgyadlehkedcveeffhlqhy
ldtataprlfdklk

Timeline for d3cxhq_:

• d3cxhq_ first appeared in SCOP 1.75, called d3cxhq1
  
• d3cxhq_ appears in SCOPe 2.06
  
• d3cxhq_ appears in the current release, SCOPe 2.08