![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
![]() | Superfamily b.33.1: ISP domain [50022] (3 families) ![]() |
![]() | Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (8 proteins) |
![]() | Protein ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain [50024] (3 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63741] (7 PDB entries) |
![]() | Domain d3cxhp1: 3cxh P:87-215 [157133] Other proteins in same PDB: d3cxha1, d3cxha2, d3cxhb1, d3cxhb2, d3cxhc1, d3cxhc2, d3cxhd1, d3cxhd2, d3cxhe2, d3cxhf1, d3cxhg1, d3cxhh1, d3cxhi1, d3cxhj1, d3cxhk1, d3cxhl1, d3cxhl2, d3cxhm1, d3cxhm2, d3cxhn1, d3cxhn2, d3cxho1, d3cxho2, d3cxhp2, d3cxhq1, d3cxhr1, d3cxhs1, d3cxht1, d3cxhu1, d3cxhv1 automatically matched to d1ezve1 complexed with 6ph, 7ph, 8pe, 9pe, cn6, fes, hem, m3l, sma, suc, umq |
PDB Entry: 3cxh (more details), 2.5 Å
SCOP Domain Sequences for d3cxhp1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cxhp1 b.33.1.1 (P:87-215) ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} dvlamakvevnlaaiplgknvvvkwqgkpvfirhrtpheiqeansvdmsalkdpqtdadr vkdpqwlimlgicthlgcvpigeagdfggwfcpchgshydisgrirkgpaplnleipaye fdgdkvivg
Timeline for d3cxhp1:
![]() Domains from other chains: (mouse over for more information) d3cxha1, d3cxha2, d3cxhb1, d3cxhb2, d3cxhc1, d3cxhc2, d3cxhd1, d3cxhd2, d3cxhe1, d3cxhe2, d3cxhf1, d3cxhg1, d3cxhh1, d3cxhi1, d3cxhj1, d3cxhk1, d3cxhl1, d3cxhl2, d3cxhm1, d3cxhm2, d3cxhn1, d3cxhn2, d3cxho1, d3cxho2, d3cxhq1, d3cxhr1, d3cxhs1, d3cxht1, d3cxhu1, d3cxhv1 |