SCOP 1.75: Domain d3cxhh1: 3cxh H:2-94

Lineage for d3cxhh1 (3cxh H:2-94)

1. Root: SCOP 1.75

2. Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)

3. Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
   not a true fold

4. Superfamily f.23.13: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81508] (1 family)

5. Family f.23.13.1: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81507] (1 protein)

6. Protein Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81506] (3 species)
   together with cytochrome b binds to ubiquinone

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81505] (7 PDB entries)

8. Domain d3cxhh1: 3cxh H:2-94 [157121]
   Other proteins in same PDB: d3cxha1, d3cxha2, d3cxhb1, d3cxhb2, d3cxhc1, d3cxhc2, d3cxhd1, d3cxhd2, d3cxhe1, d3cxhe2, d3cxhf1, d3cxhg1, d3cxhi1, d3cxhj1, d3cxhk1, d3cxhl1, d3cxhl2, d3cxhm1, d3cxhm2, d3cxhn1, d3cxhn2, d3cxho1, d3cxho2, d3cxhp1, d3cxhp2, d3cxhq1, d3cxhr1, d3cxht1, d3cxhu1, d3cxhv1
   automatically matched to d1ezvg_
   complexed with 6ph, 7ph, 8pe, 9pe, cn6, fes, hem, m3l, sma, suc, umq

Details for d3cxhh1

PDB Entry: 3cxh, 2.5 Å

PDB Description: structure of yeast complex iii with isoform-2 cytochrome c bound and definition of a minimal core interface for electron transfer.

PDB Compounds: (H:) Cytochrome b-c1 complex subunit 8

SCOP Domain Sequences for d3cxhh1:

Sequence; same for both SEQRES and ATOM records:

>d3cxhh1 f.23.13.1 (H:2-94) Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gppsgktymgwwghmggpkqkgitsyavspyaqkplqgifhnavfnsfrrfksqflyvli
pagiywywwkngneyneflyskagreelervnv

Timeline for d3cxhh1:

• d3cxhh1 is new in SCOP 1.75
  
• d3cxhh1 is called d3cxhh_ in SCOPe 2.01
  
• d3cxhh1 appears in the current release, SCOPe 2.08, called d3cxhh_