Lineage for d3cxhh1 (3cxh H:2-94)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 887128Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 887523Superfamily f.23.13: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81508] (1 family) (S)
  5. 887524Family f.23.13.1: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81507] (1 protein)
  6. 887525Protein Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81506] (3 species)
    together with cytochrome b binds to ubiquinone
  7. 887526Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81505] (7 PDB entries)
  8. 887532Domain d3cxhh1: 3cxh H:2-94 [157121]
    Other proteins in same PDB: d3cxha1, d3cxha2, d3cxhb1, d3cxhb2, d3cxhc1, d3cxhc2, d3cxhd1, d3cxhd2, d3cxhe1, d3cxhe2, d3cxhf1, d3cxhg1, d3cxhi1, d3cxhj1, d3cxhk1, d3cxhl1, d3cxhl2, d3cxhm1, d3cxhm2, d3cxhn1, d3cxhn2, d3cxho1, d3cxho2, d3cxhp1, d3cxhp2, d3cxhq1, d3cxhr1, d3cxht1, d3cxhu1, d3cxhv1
    automatically matched to d1ezvg_
    complexed with 6ph, 7ph, 8pe, 9pe, cn6, fes, hem, m3l, sma, suc, umq

Details for d3cxhh1

PDB Entry: 3cxh (more details), 2.5 Å

PDB Description: Structure of yeast complex III with isoform-2 cytochrome c bound and definition of a minimal core interface for electron transfer.
PDB Compounds: (H:) Cytochrome b-c1 complex subunit 8

SCOP Domain Sequences for d3cxhh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cxhh1 f.23.13.1 (H:2-94) Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gppsgktymgwwghmggpkqkgitsyavspyaqkplqgifhnavfnsfrrfksqflyvli
pagiywywwkngneyneflyskagreelervnv

SCOP Domain Coordinates for d3cxhh1:

Click to download the PDB-style file with coordinates for d3cxhh1.
(The format of our PDB-style files is described here.)

Timeline for d3cxhh1: