SCOP 1.55: Domain d1sera1: 1ser A:1-110

Lineage for d1sera1 (1ser A:1-110)

1. Root: SCOP 1.55

2. Class a: All alpha proteins [46456] (138 folds)

3. Fold a.2: Long alpha-hairpin [46556] (11 superfamilies)

4. Superfamily a.2.7: A class II aminoacyl-tRNA synthetase N-domain [46589] (2 families)

5. Family a.2.7.1: Seryl-tRNA synthetase (SerRS) [46590] (1 protein)

6. Protein Seryl-tRNA synthetase (SerRS) [46591] (1 species)

7. Species Thermus thermophilus, strain hb27 [TaxId:274] [46592] (4 PDB entries)

8. Domain d1sera1: 1ser A:1-110 [15712]
   Other proteins in same PDB: d1sera2, d1serb2

Details for d1sera1

PDB Entry: 1ser, 2.9 Å

PDB Description: the 2.9 angstroms crystal structure of t. thermophilus seryl-trna synthetase complexed with trna ser

SCOP Domain Sequences for d1sera1:

Sequence, based on SEQRES records:

>d1sera1 a.2.7.1 (A:1-110) Seryl-tRNA synthetase (SerRS) {Thermus thermophilus, strain hb27}
mvdlkrlrqepevfhrairekgvaldleallaldrevqelkkrlqevqternqvakrvpk
appeekealiargkalgeeakrleealrekearlealllqvplppwpgap

Sequence, based on observed residues (ATOM records):

>d1sera1 a.2.7.1 (A:1-110) Seryl-tRNA synthetase (SerRS) {Thermus thermophilus, strain hb27}
mvdlkrlrqepevfhrairekgvaldleallaldrevqrekearlealllqvplppwpga
p

Timeline for d1sera1:

• d1sera1 appears in SCOP 1.57
  
• d1sera1 appears in the current release, SCOPe 2.08