Lineage for d1sera1 (1ser A:1-110)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2689745Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2689956Superfamily a.2.7: tRNA-binding arm [46589] (5 families) (S)
    formerly a class II aminoacyl-tRNA synthetase N-domain
  5. 2689957Family a.2.7.1: Seryl-tRNA synthetase (SerRS) [46590] (1 protein)
    automatically mapped to Pfam PF02403
  6. 2689958Protein Seryl-tRNA synthetase (SerRS) [46591] (1 species)
  7. 2689959Species Thermus thermophilus, strain hb27 [TaxId:274] [46592] (4 PDB entries)
  8. 2689966Domain d1sera1: 1ser A:1-110 [15712]
    Other proteins in same PDB: d1sera2, d1serb2
    protein/RNA complex
    fragment; missing more than one-third of the common structure and/or sequence

Details for d1sera1

PDB Entry: 1ser (more details), 2.9 Å

PDB Description: the 2.9 angstroms crystal structure of t. thermophilus seryl-trna synthetase complexed with trna ser
PDB Compounds: (A:) protein (seryl-tRNA synthetase (e.c.6.1.1.11))

SCOPe Domain Sequences for d1sera1:

Sequence, based on SEQRES records: (download)

>d1sera1 a.2.7.1 (A:1-110) Seryl-tRNA synthetase (SerRS) {Thermus thermophilus, strain hb27 [TaxId: 274]}
mvdlkrlrqepevfhrairekgvaldleallaldrevqelkkrlqevqternqvakrvpk
appeekealiargkalgeeakrleealrekearlealllqvplppwpgap

Sequence, based on observed residues (ATOM records): (download)

>d1sera1 a.2.7.1 (A:1-110) Seryl-tRNA synthetase (SerRS) {Thermus thermophilus, strain hb27 [TaxId: 274]}
mvdlkrlrqepevfhrairekgvaldleallaldrevqrekearlealllqvplppwpga
p

SCOPe Domain Coordinates for d1sera1:

Click to download the PDB-style file with coordinates for d1sera1.
(The format of our PDB-style files is described here.)

Timeline for d1sera1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sera2