SCOPe 2.07: Domain d3cxhd2: 3cxh D:261-307

Lineage for d3cxhd2 (3cxh D:261-307)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.11: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81496] (2 families)

5. Family f.23.11.1: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81495] (1 protein)

6. Protein Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81494] (4 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81493] (7 PDB entries)

8. Domain d3cxhd2: 3cxh D:261-307 [157116]
   Other proteins in same PDB: d3cxha1, d3cxha2, d3cxhb1, d3cxhb2, d3cxhc1, d3cxhc2, d3cxhd1, d3cxhe1, d3cxhe2, d3cxhf_, d3cxhg_, d3cxhh_, d3cxhi_, d3cxhj_, d3cxhk_, d3cxhl1, d3cxhl2, d3cxhm1, d3cxhm2, d3cxhn1, d3cxhn2, d3cxho1, d3cxhp1, d3cxhp2, d3cxhq_, d3cxhr_, d3cxhs_, d3cxht_, d3cxhu_, d3cxhv_, d3cxhw_
   automated match to d1kyod2
   complexed with 6ph, 7ph, 8pe, 9pe, cn6, fes, hem, sma, suc, umq

Details for d3cxhd2

PDB Entry: 3cxh, 2.5 Å

PDB Description: structure of yeast complex iii with isoform-2 cytochrome c bound and definition of a minimal core interface for electron transfer.

PDB Compounds: (D:) Cytochrome c1, heme protein, mitochondrial

SCOPe Domain Sequences for d3cxhd2:

Sequence; same for both SEQRES and ATOM records:

>d3cxhd2 f.23.11.1 (D:261-307) Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pehderkrlglktviilsslyllsiwvkkfkwagiktrkfvfnppkp

Timeline for d3cxhd2:

• d3cxhd2 first appeared in SCOP 1.75
  
• d3cxhd2 appears in SCOPe 2.06
  
• d3cxhd2 appears in the current release, SCOPe 2.08