SCOPe 2.07: Domain d3cxhc2: 3cxh C:1-261

Lineage for d3cxhc2 (3cxh C:1-261)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
   core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices

4. Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families)
   Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically

5. Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (3 proteins)
   a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria

6. Protein automated matches [196844] (6 species)
   not a true protein

7. Species Saccharomyces cerevisiae [TaxId:764097] [255785] (2 PDB entries)

8. Domain d3cxhc2: 3cxh C:1-261 [157114]
   Other proteins in same PDB: d3cxha1, d3cxha2, d3cxhb1, d3cxhb2, d3cxhc1, d3cxhd1, d3cxhd2, d3cxhe1, d3cxhe2, d3cxhf_, d3cxhg_, d3cxhh_, d3cxhi_, d3cxhj_, d3cxhk_, d3cxhl1, d3cxhl2, d3cxhm1, d3cxhm2, d3cxhn1, d3cxho1, d3cxho2, d3cxhp1, d3cxhp2, d3cxhq_, d3cxhr_, d3cxhs_, d3cxht_, d3cxhu_, d3cxhv_, d3cxhw_
   automated match to d1kb9c2
   complexed with 6ph, 7ph, 8pe, 9pe, cn6, fes, hem, sma, suc, umq

Details for d3cxhc2

PDB Entry: 3cxh, 2.5 Å

PDB Description: structure of yeast complex iii with isoform-2 cytochrome c bound and definition of a minimal core interface for electron transfer.

PDB Compounds: (C:) cytochrome b

SCOPe Domain Sequences for d3cxhc2:

Sequence; same for both SEQRES and ATOM records:

>d3cxhc2 f.21.1.2 (C:1-261) automated matches {Saccharomyces cerevisiae [TaxId: 764097]}
mafrksnvylslvnsyiidspqpssinywwnmgsllglclviqivtgifmamhyssniel
afssvehimrdvhngyilrylhangasfffmvmfmhmakglyygsyrsprvtlwnvgvii
filtiataflgyccvygqmshwgatvitnlfsaipfvgndivswlwggfsvsnptiqrff
alhylvpfiiaamvimhlmalhihgssnplgitgnldripmhsyfifkdlvtvflfmlil
alfvfyspntlghpdnyipgn

Timeline for d3cxhc2:

• d3cxhc2 first appeared in SCOP 1.75
  
• d3cxhc2 appears in SCOPe 2.06
  
• d3cxhc2 appears in the current release, SCOPe 2.08