| Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
| Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily) core: three transmembrane helices, up-and-down bundle |
Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (2 families) ![]() |
| Family f.32.1.0: automated matches [254197] (1 protein) not a true family |
| Protein automated matches [254431] (4 species) not a true protein |
| Species Saccharomyces cerevisiae [TaxId:764097] [255786] (2 PDB entries) |
| Domain d3cxhc1: 3cxh C:262-385 [157113] Other proteins in same PDB: d3cxha1, d3cxha2, d3cxhb1, d3cxhb2, d3cxhc2, d3cxhd1, d3cxhd2, d3cxhe1, d3cxhe2, d3cxhf_, d3cxhg_, d3cxhh_, d3cxhi_, d3cxhj_, d3cxhk_, d3cxhl1, d3cxhl2, d3cxhm1, d3cxhm2, d3cxhn2, d3cxho1, d3cxho2, d3cxhp1, d3cxhp2, d3cxhq_, d3cxhr_, d3cxhs_, d3cxht_, d3cxhu_, d3cxhv_, d3cxhw_ automated match to d1kb9c1 complexed with 6ph, 7ph, 8pe, 9pe, cn6, fes, hem, sma, suc, umq |
PDB Entry: 3cxh (more details), 2.5 Å
SCOPe Domain Sequences for d3cxhc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cxhc1 f.32.1.0 (C:262-385) automated matches {Saccharomyces cerevisiae [TaxId: 764097]}
plvtpasivpewyllpfyailrsipdkllgvitmfaailvllvlpftdrsvvrgntfkvl
skffffifvfnfvllgqigachvevpyvlmgqiatfiyfayfliivpvistienvlfyig
rvnk
Timeline for d3cxhc1:
View in 3DDomains from other chains: (mouse over for more information) d3cxha1, d3cxha2, d3cxhb1, d3cxhb2, d3cxhd1, d3cxhd2, d3cxhe1, d3cxhe2, d3cxhf_, d3cxhg_, d3cxhh_, d3cxhi_, d3cxhj_, d3cxhk_, d3cxhl1, d3cxhl2, d3cxhm1, d3cxhm2, d3cxhn1, d3cxhn2, d3cxho1, d3cxho2, d3cxhp1, d3cxhp2, d3cxhq_, d3cxhr_, d3cxhs_, d3cxht_, d3cxhu_, d3cxhv_, d3cxhw_ |