Lineage for d3cxhc1 (3cxh C:262-385)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 888181Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily)
    core: three transmembrane helices, up-and-down bundle
  4. 888182Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (1 family) (S)
  5. 888183Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (2 proteins)
    a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria
  6. 888184Protein Mitochondrial cytochrome b subunit, C-terminal domain [81646] (3 species)
  7. 888185Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81645] (7 PDB entries)
  8. 888191Domain d3cxhc1: 3cxh C:262-385 [157113]
    Other proteins in same PDB: d3cxha1, d3cxha2, d3cxhb1, d3cxhb2, d3cxhc2, d3cxhd1, d3cxhd2, d3cxhe1, d3cxhe2, d3cxhf1, d3cxhg1, d3cxhh1, d3cxhi1, d3cxhj1, d3cxhk1, d3cxhl1, d3cxhl2, d3cxhm1, d3cxhm2, d3cxhn2, d3cxho1, d3cxho2, d3cxhp1, d3cxhp2, d3cxhq1, d3cxhr1, d3cxhs1, d3cxht1, d3cxhu1, d3cxhv1
    automatically matched to d1ezvc2
    complexed with 6ph, 7ph, 8pe, 9pe, cn6, fes, hem, m3l, sma, suc, umq

Details for d3cxhc1

PDB Entry: 3cxh (more details), 2.5 Å

PDB Description: Structure of yeast complex III with isoform-2 cytochrome c bound and definition of a minimal core interface for electron transfer.
PDB Compounds: (C:) cytochrome b

SCOP Domain Sequences for d3cxhc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cxhc1 f.32.1.1 (C:262-385) Mitochondrial cytochrome b subunit, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
plvtpasivpewyllpfyailrsipdkllgvitmfaailvllvlpftdrsvvrgntfkvl
skffffifvfnfvllgqigachvevpyvlmgqiatfiyfayfliivpvistienvlfyig
rvnk

SCOP Domain Coordinates for d3cxhc1:

Click to download the PDB-style file with coordinates for d3cxhc1.
(The format of our PDB-style files is described here.)

Timeline for d3cxhc1: