Lineage for d3cxhb1 (3cxh B:17-218)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 879393Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 879394Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 879395Family d.185.1.1: MPP-like [63412] (6 proteins)
    Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal
  6. 879470Protein Cytochrome bc1 core subunit 2 [63409] (3 species)
  7. 879471Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64305] (7 PDB entries)
  8. 879482Domain d3cxhb1: 3cxh B:17-218 [157111]
    Other proteins in same PDB: d3cxha1, d3cxha2, d3cxhc1, d3cxhc2, d3cxhd1, d3cxhd2, d3cxhe1, d3cxhe2, d3cxhf1, d3cxhg1, d3cxhh1, d3cxhi1, d3cxhj1, d3cxhk1, d3cxhl1, d3cxhl2, d3cxhn1, d3cxhn2, d3cxho1, d3cxho2, d3cxhp1, d3cxhp2, d3cxhq1, d3cxhr1, d3cxhs1, d3cxht1, d3cxhu1, d3cxhv1
    automatically matched to d1ezvb1
    complexed with 6ph, 7ph, 8pe, 9pe, cn6, fes, hem, m3l, sma, suc, umq

Details for d3cxhb1

PDB Entry: 3cxh (more details), 2.5 Å

PDB Description: structure of yeast complex iii with isoform-2 cytochrome c bound and definition of a minimal core interface for electron transfer.
PDB Compounds: (B:) Cytochrome b-c1 complex subunit 2, mitochondrial

SCOP Domain Sequences for d3cxhb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cxhb1 d.185.1.1 (B:17-218) Cytochrome bc1 core subunit 2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ltvsardaptkistlavkvhggsryatkdgvahllnrfnfqntntrsalklvresellgg
tfkstldreyitlkatflkddlpyyvnaladvlyktafkpheltesvlpaarydyavaeq
cpvksaedqlyaitfrkglgnpllydgvervslqdikdfadkvytkenlevsgenvvead
lkrfvdesllstlpagkslvsk

SCOP Domain Coordinates for d3cxhb1:

Click to download the PDB-style file with coordinates for d3cxhb1.
(The format of our PDB-style files is described here.)

Timeline for d3cxhb1: