Lineage for d3cxha2 (3cxh A:240-457)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1049845Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 1049846Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 1049847Family d.185.1.1: MPP-like [63412] (6 proteins)
    Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal
  6. 1049848Protein Cytochrome bc1 core subunit 1 [63408] (3 species)
  7. 1049849Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64304] (7 PDB entries)
  8. 1049861Domain d3cxha2: 3cxh A:240-457 [157110]
    Other proteins in same PDB: d3cxhb1, d3cxhb2, d3cxhc1, d3cxhc2, d3cxhd1, d3cxhd2, d3cxhe1, d3cxhe2, d3cxhf1, d3cxhg_, d3cxhh_, d3cxhi_, d3cxhj_, d3cxhk_, d3cxhm1, d3cxhm2, d3cxhn1, d3cxhn2, d3cxho1, d3cxho2, d3cxhp1, d3cxhp2, d3cxhq1, d3cxhr_, d3cxhs_, d3cxht_, d3cxhu_, d3cxhv_, d3cxhw_
    automatically matched to d1kb9a2
    complexed with 6ph, 7ph, 8pe, 9pe, cn6, fes, hem, sma, suc, umq

Details for d3cxha2

PDB Entry: 3cxh (more details), 2.5 Å

PDB Description: structure of yeast complex iii with isoform-2 cytochrome c bound and definition of a minimal core interface for electron transfer.
PDB Compounds: (A:) Cytochrome b-c1 complex subunit 1, mitochondrial

SCOPe Domain Sequences for d3cxha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cxha2 d.185.1.1 (A:240-457) Cytochrome bc1 core subunit 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kkaaflgsevrlrddtlpkawislavegepvnspnyfvaklaaqifgsynafepasrlqg
iklldniqeyqlcdnfnhfslsykdsglwgfstatrnvtmiddlihftlkqwnrltisvt
dteveraksllklqlgqlyesgnpvndanllgaevlikgsklslgeafkkidaitvkdvk
awagkrlwdqdiaiagtgqieglldymrirsdmsmmrw

SCOPe Domain Coordinates for d3cxha2:

Click to download the PDB-style file with coordinates for d3cxha2.
(The format of our PDB-style files is described here.)

Timeline for d3cxha2: