Lineage for d1sesb1 (1ses B:1-110)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2689745Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2689956Superfamily a.2.7: tRNA-binding arm [46589] (5 families) (S)
    formerly a class II aminoacyl-tRNA synthetase N-domain
  5. 2689957Family a.2.7.1: Seryl-tRNA synthetase (SerRS) [46590] (1 protein)
    automatically mapped to Pfam PF02403
  6. 2689958Protein Seryl-tRNA synthetase (SerRS) [46591] (1 species)
  7. 2689959Species Thermus thermophilus, strain hb27 [TaxId:274] [46592] (4 PDB entries)
  8. 2689965Domain d1sesb1: 1ses B:1-110 [15711]
    Other proteins in same PDB: d1sesa2, d1sesb2
    protein/RNA complex; complexed with ahx, amp

Details for d1sesb1

PDB Entry: 1ses (more details), 2.5 Å

PDB Description: crystal structures at 2.5 angstroms resolution of seryl-trna synthetase complexed with two different analogues of seryl-adenylate
PDB Compounds: (B:) SERYL-tRNA SYNTHETASE

SCOPe Domain Sequences for d1sesb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sesb1 a.2.7.1 (B:1-110) Seryl-tRNA synthetase (SerRS) {Thermus thermophilus, strain hb27 [TaxId: 274]}
mvdlkrlrqepevfhrairekgvaldleallaldrevqelkkrlqevqternqvakrvpk
appeekealiargkalgeeakrleealrekearlealllqvplppwpgap

SCOPe Domain Coordinates for d1sesb1:

Click to download the PDB-style file with coordinates for d1sesb1.
(The format of our PDB-style files is described here.)

Timeline for d1sesb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sesb2