Lineage for d3cx5q_ (3cx5 Q:)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1959134Fold f.28: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81532] (1 superfamily)
    membrane-associated alpha-helical protein; no transmembrane helices
  4. 1959135Superfamily f.28.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81531] (1 family) (S)
    location - intermembrane side of the bc1 complex
    automatically mapped to Pfam PF02320
  5. 1959136Family f.28.1.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81530] (2 proteins)
    "acidic/hinge protein", essential for the complex formation, interacts with the functional domain of cytochrome c1
  6. 1959166Protein automated matches [190042] (3 species)
    not a true protein
  7. 1959192Species Saccharomyces cerevisiae [TaxId:764097] [255784] (2 PDB entries)
  8. 1959194Domain d3cx5q_: 3cx5 Q: [157102]
    Other proteins in same PDB: d3cx5a1, d3cx5a2, d3cx5b1, d3cx5b2, d3cx5c1, d3cx5c2, d3cx5d1, d3cx5d2, d3cx5e1, d3cx5e2, d3cx5g_, d3cx5h_, d3cx5i_, d3cx5j_, d3cx5k_, d3cx5l1, d3cx5l2, d3cx5m1, d3cx5m2, d3cx5n1, d3cx5n2, d3cx5o1, d3cx5o2, d3cx5p1, d3cx5p2, d3cx5r_, d3cx5s_, d3cx5t_, d3cx5u_, d3cx5v_, d3cx5w_
    automated match to d3cx5q1
    complexed with 6ph, 7ph, 8pe, 9pe, cn3, cn5, fes, hem, sma, suc, umq

Details for d3cx5q_

PDB Entry: 3cx5 (more details), 1.9 Å

PDB Description: Structure of complex III with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer.
PDB Compounds: (Q:) Cytochrome b-c1 complex subunit 6

SCOPe Domain Sequences for d3cx5q_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cx5q_ f.28.1.1 (Q:) automated matches {Saccharomyces cerevisiae [TaxId: 764097]}
vtdqledlrehfknteegkalvhhyeecaervkiqqqqpgyadlehkedcveeffhlqhy
ldtataprlfdklk

SCOPe Domain Coordinates for d3cx5q_:

Click to download the PDB-style file with coordinates for d3cx5q_.
(The format of our PDB-style files is described here.)

Timeline for d3cx5q_: