Lineage for d3cx5p1 (3cx5 P:87-215)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1309647Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 1309648Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 1309649Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins)
  6. 1309672Protein ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain [50024] (3 species)
  7. 1309673Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63741] (7 PDB entries)
  8. 1309675Domain d3cx5p1: 3cx5 P:87-215 [157100]
    Other proteins in same PDB: d3cx5a1, d3cx5a2, d3cx5b1, d3cx5b2, d3cx5c1, d3cx5c2, d3cx5d1, d3cx5d2, d3cx5e2, d3cx5f1, d3cx5g_, d3cx5h_, d3cx5i_, d3cx5j_, d3cx5k_, d3cx5l1, d3cx5l2, d3cx5m1, d3cx5m2, d3cx5n1, d3cx5n2, d3cx5o1, d3cx5o2, d3cx5p2, d3cx5q1, d3cx5r_, d3cx5s_, d3cx5t_, d3cx5u_, d3cx5v_, d3cx5w_
    automated match to d1kb9e1
    complexed with 6ph, 7ph, 8pe, 9pe, cn3, cn5, fes, hem, sma, suc, umq

Details for d3cx5p1

PDB Entry: 3cx5 (more details), 1.9 Å

PDB Description: structure of complex iii with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer.
PDB Compounds: (P:) Cytochrome b-c1 complex subunit Rieske, mitochondrial

SCOPe Domain Sequences for d3cx5p1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cx5p1 b.33.1.1 (P:87-215) ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dvlamakvevnlaaiplgknvvvkwqgkpvfirhrtpheiqeansvdmsalkdpqtdadr
vkdpqwlimlgicthlgcvpigeagdfggwfcpchgshydisgrirkgpaplnleipaye
fdgdkvivg

SCOPe Domain Coordinates for d3cx5p1:

Click to download the PDB-style file with coordinates for d3cx5p1.
(The format of our PDB-style files is described here.)

Timeline for d3cx5p1: