Lineage for d3cx5n1 (3cx5 N:262-385)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3027980Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily)
    core: three transmembrane helices, up-and-down bundle
  4. 3027981Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (2 families) (S)
  5. 3028050Family f.32.1.0: automated matches [254197] (1 protein)
    not a true family
  6. 3028051Protein automated matches [254431] (4 species)
    not a true protein
  7. 3028069Species Saccharomyces cerevisiae [TaxId:764097] [255786] (2 PDB entries)
  8. 3028071Domain d3cx5n1: 3cx5 N:262-385 [157096]
    Other proteins in same PDB: d3cx5a1, d3cx5a2, d3cx5b1, d3cx5b2, d3cx5c2, d3cx5d1, d3cx5d2, d3cx5e1, d3cx5e2, d3cx5f_, d3cx5g_, d3cx5h_, d3cx5i_, d3cx5j_, d3cx5k_, d3cx5l1, d3cx5l2, d3cx5m1, d3cx5m2, d3cx5n2, d3cx5o1, d3cx5o2, d3cx5p1, d3cx5p2, d3cx5q_, d3cx5r_, d3cx5s_, d3cx5t_, d3cx5u_, d3cx5v_, d3cx5w_
    automated match to d3cx5n1
    complexed with 6ph, 7ph, 8pe, 9pe, cn3, cn5, fes, hem, sma, umq

Details for d3cx5n1

PDB Entry: 3cx5 (more details), 1.9 Å

PDB Description: structure of complex iii with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer.
PDB Compounds: (N:) cytochrome b

SCOPe Domain Sequences for d3cx5n1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cx5n1 f.32.1.0 (N:262-385) automated matches {Saccharomyces cerevisiae [TaxId: 764097]}
plvtpasivpewyllpfyailrsipdkllgvitmfaailvllvlpftdrsvvrgntfkvl
skffffifvfnfvllgqigachvevpyvlmgqiatfiyfayfliivpvistienvlfyig
rvnk

SCOPe Domain Coordinates for d3cx5n1:

Click to download the PDB-style file with coordinates for d3cx5n1.
(The format of our PDB-style files is described here.)

Timeline for d3cx5n1: