Lineage for d3cx5c2 (3cx5 C:1-261)

  1. Root: SCOPe 2.04
  2. 1695624Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1697409Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
    core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices
  4. 1697410Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families) (S)
    Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically
  5. 1697416Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (3 proteins)
    a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria
  6. 1697471Protein automated matches [196844] (6 species)
    not a true protein
  7. 1697491Species Saccharomyces cerevisiae [TaxId:764097] [255785] (2 PDB entries)
  8. 1697492Domain d3cx5c2: 3cx5 C:1-261 [157081]
    Other proteins in same PDB: d3cx5a1, d3cx5a2, d3cx5b1, d3cx5b2, d3cx5c1, d3cx5d1, d3cx5d2, d3cx5e1, d3cx5e2, d3cx5f_, d3cx5g_, d3cx5h_, d3cx5i_, d3cx5j_, d3cx5k_, d3cx5l1, d3cx5l2, d3cx5m1, d3cx5m2, d3cx5n1, d3cx5o1, d3cx5o2, d3cx5p1, d3cx5p2, d3cx5q_, d3cx5r_, d3cx5s_, d3cx5t_, d3cx5u_, d3cx5v_, d3cx5w_
    automated match to d1kb9c2
    complexed with 6ph, 7ph, 8pe, 9pe, cn3, cn5, fes, hem, sma, suc, umq

Details for d3cx5c2

PDB Entry: 3cx5 (more details), 1.9 Å

PDB Description: Structure of complex III with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer.
PDB Compounds: (C:) cytochrome b

SCOPe Domain Sequences for d3cx5c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cx5c2 f.21.1.2 (C:1-261) automated matches {Saccharomyces cerevisiae}
mafrksnvylslvnsyiidspqpssinywwnmgsllglclviqivtgifmamhyssniel
afssvehimrdvhngyilrylhangasfffmvmfmhmakglyygsyrsprvtlwnvgvii
filtiataflgyccvygqmshwgatvitnlfsaipfvgndivswlwggfsvsnptiqrff
alhylvpfiiaamvimhlmalhihgssnplgitgnldripmhsyfifkdlvtvflfmlil
alfvfyspntlghpdnyipgn

SCOPe Domain Coordinates for d3cx5c2:

Click to download the PDB-style file with coordinates for d3cx5c2.
(The format of our PDB-style files is described here.)

Timeline for d3cx5c2: