Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily) core: three transmembrane helices, up-and-down bundle |
Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (1 family) |
Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (2 proteins) a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria |
Protein Mitochondrial cytochrome b subunit, C-terminal domain [81646] (3 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81645] (7 PDB entries) |
Domain d3cx5c1: 3cx5 C:262-385 [157080] Other proteins in same PDB: d3cx5a1, d3cx5a2, d3cx5b1, d3cx5b2, d3cx5c2, d3cx5d1, d3cx5d2, d3cx5e1, d3cx5e2, d3cx5f1, d3cx5g_, d3cx5h_, d3cx5i_, d3cx5j_, d3cx5k_, d3cx5l1, d3cx5l2, d3cx5m1, d3cx5m2, d3cx5n2, d3cx5o1, d3cx5o2, d3cx5p1, d3cx5p2, d3cx5q1, d3cx5r_, d3cx5s_, d3cx5t_, d3cx5u_, d3cx5v_, d3cx5w_ automatically matched to d1ezvc2 complexed with 6ph, 7ph, 8pe, 9pe, cn3, cn5, fes, hem, sma, suc, umq |
PDB Entry: 3cx5 (more details), 1.9 Å
SCOPe Domain Sequences for d3cx5c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cx5c1 f.32.1.1 (C:262-385) Mitochondrial cytochrome b subunit, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} plvtpasivpewyllpfyailrsipdkllgvitmfaailvllvlpftdrsvvrgntfkvl skffffifvfnfvllgqigachvevpyvlmgqiatfiyfayfliivpvistienvlfyig rvnk
Timeline for d3cx5c1:
View in 3D Domains from other chains: (mouse over for more information) d3cx5a1, d3cx5a2, d3cx5b1, d3cx5b2, d3cx5d1, d3cx5d2, d3cx5e1, d3cx5e2, d3cx5f1, d3cx5g_, d3cx5h_, d3cx5i_, d3cx5j_, d3cx5k_, d3cx5l1, d3cx5l2, d3cx5m1, d3cx5m2, d3cx5n1, d3cx5n2, d3cx5o1, d3cx5o2, d3cx5p1, d3cx5p2, d3cx5q1, d3cx5r_, d3cx5s_, d3cx5t_, d3cx5u_, d3cx5v_, d3cx5w_ |