| Class f: Membrane and cell surface proteins and peptides [56835] (58 folds) |
| Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily) core: three transmembrane helices, up-and-down bundle |
Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (1 family) ![]() |
| Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (2 proteins) a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria |
| Protein Mitochondrial cytochrome b subunit, C-terminal domain [81646] (3 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81645] (7 PDB entries) |
| Domain d3cx5c1: 3cx5 C:262-385 [157080] Other proteins in same PDB: d3cx5a1, d3cx5a2, d3cx5b1, d3cx5b2, d3cx5c2, d3cx5d1, d3cx5d2, d3cx5e1, d3cx5e2, d3cx5f1, d3cx5g1, d3cx5h1, d3cx5i1, d3cx5j1, d3cx5k1, d3cx5l1, d3cx5l2, d3cx5m1, d3cx5m2, d3cx5n2, d3cx5o1, d3cx5o2, d3cx5p1, d3cx5p2, d3cx5q1, d3cx5r1, d3cx5s1, d3cx5t1, d3cx5u1, d3cx5v1 automatically matched to d1ezvc2 complexed with 6ph, 7ph, 8pe, 9pe, cn3, cn5, fes, hem, m3l, sma, suc, umq |
PDB Entry: 3cx5 (more details), 1.9 Å
SCOP Domain Sequences for d3cx5c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cx5c1 f.32.1.1 (C:262-385) Mitochondrial cytochrome b subunit, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
plvtpasivpewyllpfyailrsipdkllgvitmfaailvllvlpftdrsvvrgntfkvl
skffffifvfnfvllgqigachvevpyvlmgqiatfiyfayfliivpvistienvlfyig
rvnk
Timeline for d3cx5c1:
View in 3DDomains from other chains: (mouse over for more information) d3cx5a1, d3cx5a2, d3cx5b1, d3cx5b2, d3cx5d1, d3cx5d2, d3cx5e1, d3cx5e2, d3cx5f1, d3cx5g1, d3cx5h1, d3cx5i1, d3cx5j1, d3cx5k1, d3cx5l1, d3cx5l2, d3cx5m1, d3cx5m2, d3cx5n1, d3cx5n2, d3cx5o1, d3cx5o2, d3cx5p1, d3cx5p2, d3cx5q1, d3cx5r1, d3cx5s1, d3cx5t1, d3cx5u1, d3cx5v1 |