SCOPe 2.05: Domain d1seta1: 1set A:1-110

Lineage for d1seta1 (1set A:1-110)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.7: tRNA-binding arm [46589] (5 families)
   formerly a class II aminoacyl-tRNA synthetase N-domain

5. Family a.2.7.1: Seryl-tRNA synthetase (SerRS) [46590] (1 protein)
   automatically mapped to Pfam PF02403

6. Protein Seryl-tRNA synthetase (SerRS) [46591] (1 species)

7. Species Thermus thermophilus, strain hb27 [TaxId:274] [46592] (4 PDB entries)

8. Domain d1seta1: 1set A:1-110 [15708]
   Other proteins in same PDB: d1seta2, d1setb2
   protein/RNA complex; complexed with ssa

Details for d1seta1

PDB Entry: 1set, 2.55 Å

PDB Description: crystal structures at 2.5 angstroms resolution of seryl-trna synthetase complexed with two different analogues of seryl-adenylate

PDB Compounds: (A:) SERYL-tRNA SYNTHETASE

SCOPe Domain Sequences for d1seta1:

Sequence; same for both SEQRES and ATOM records:

>d1seta1 a.2.7.1 (A:1-110) Seryl-tRNA synthetase (SerRS) {Thermus thermophilus, strain hb27 [TaxId: 274]}
mvdlkrlrqepevfhrairekgvaldleallaldrevqelkkrlqevqternqvakrvpk
appeekealiargkalgeeakrleealrekearlealllqvplppwpgap

Timeline for d1seta1:

• d1seta1 first appeared (with stable ids) in SCOP 1.55
  
• d1seta1 appears in SCOPe 2.04
  
• d1seta1 appears in SCOPe 2.06
  
• d1seta1 appears in the current release, SCOPe 2.08