Lineage for d1seta1 (1set A:1-110)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2302754Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2302960Superfamily a.2.7: tRNA-binding arm [46589] (5 families) (S)
    formerly a class II aminoacyl-tRNA synthetase N-domain
  5. 2302961Family a.2.7.1: Seryl-tRNA synthetase (SerRS) [46590] (1 protein)
    automatically mapped to Pfam PF02403
  6. 2302962Protein Seryl-tRNA synthetase (SerRS) [46591] (1 species)
  7. 2302963Species Thermus thermophilus, strain hb27 [TaxId:274] [46592] (4 PDB entries)
  8. 2302964Domain d1seta1: 1set A:1-110 [15708]
    Other proteins in same PDB: d1seta2, d1setb2
    protein/RNA complex; complexed with ssa

Details for d1seta1

PDB Entry: 1set (more details), 2.55 Å

PDB Description: crystal structures at 2.5 angstroms resolution of seryl-trna synthetase complexed with two different analogues of seryl-adenylate
PDB Compounds: (A:) SERYL-tRNA SYNTHETASE

SCOPe Domain Sequences for d1seta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1seta1 a.2.7.1 (A:1-110) Seryl-tRNA synthetase (SerRS) {Thermus thermophilus, strain hb27 [TaxId: 274]}
mvdlkrlrqepevfhrairekgvaldleallaldrevqelkkrlqevqternqvakrvpk
appeekealiargkalgeeakrleealrekearlealllqvplppwpgap

SCOPe Domain Coordinates for d1seta1:

Click to download the PDB-style file with coordinates for d1seta1.
(The format of our PDB-style files is described here.)

Timeline for d1seta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1seta2