![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
![]() | Superfamily a.2.7: tRNA-binding arm [46589] (5 families) ![]() formerly a class II aminoacyl-tRNA synthetase N-domain |
![]() | Family a.2.7.1: Seryl-tRNA synthetase (SerRS) [46590] (1 protein) automatically mapped to Pfam PF02403 |
![]() | Protein Seryl-tRNA synthetase (SerRS) [46591] (1 species) |
![]() | Species Thermus thermophilus, strain hb27 [TaxId:274] [46592] (4 PDB entries) |
![]() | Domain d1seta1: 1set A:1-110 [15708] Other proteins in same PDB: d1seta2, d1setb2 protein/RNA complex; complexed with ssa |
PDB Entry: 1set (more details), 2.55 Å
SCOPe Domain Sequences for d1seta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1seta1 a.2.7.1 (A:1-110) Seryl-tRNA synthetase (SerRS) {Thermus thermophilus, strain hb27 [TaxId: 274]} mvdlkrlrqepevfhrairekgvaldleallaldrevqelkkrlqevqternqvakrvpk appeekealiargkalgeeakrleealrekearlealllqvplppwpgap
Timeline for d1seta1: