SCOPe 2.05: Domain d1sryb1: 1sry B:1-110

Lineage for d1sryb1 (1sry B:1-110)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.7: tRNA-binding arm [46589] (5 families)
   formerly a class II aminoacyl-tRNA synthetase N-domain

5. Family a.2.7.1: Seryl-tRNA synthetase (SerRS) [46590] (1 protein)
   automatically mapped to Pfam PF02403

6. Protein Seryl-tRNA synthetase (SerRS) [46591] (1 species)

7. Species Thermus thermophilus, strain hb27 [TaxId:274] [46592] (4 PDB entries)

8. Domain d1sryb1: 1sry B:1-110 [15707]
   Other proteins in same PDB: d1srya2, d1sryb2

Details for d1sryb1

PDB Entry: 1sry, 2.5 Å

PDB Description: refined crystal structure of the seryl-trna synthetase from thermus thermophilus at 2.5 angstroms resolution

PDB Compounds: (B:) SERYL-tRNA SYNTHETASE

SCOPe Domain Sequences for d1sryb1:

Sequence; same for both SEQRES and ATOM records:

>d1sryb1 a.2.7.1 (B:1-110) Seryl-tRNA synthetase (SerRS) {Thermus thermophilus, strain hb27 [TaxId: 274]}
mvdlkrlrqepevfhrairekgvaldleallaldrevqelkkrlqevqternqvakrvpk
appeekealiargkalgeeakrleealrekearlealllqvplppwpgap

Timeline for d1sryb1:

• d1sryb1 first appeared (with stable ids) in SCOP 1.55
  
• d1sryb1 appears in SCOPe 2.04
  
• d1sryb1 appears in SCOPe 2.06
  
• d1sryb1 appears in the current release, SCOPe 2.08