| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.7: tRNA-binding arm [46589] (5 families) ![]() formerly a class II aminoacyl-tRNA synthetase N-domain |
| Family a.2.7.1: Seryl-tRNA synthetase (SerRS) [46590] (1 protein) automatically mapped to Pfam PF02403 |
| Protein Seryl-tRNA synthetase (SerRS) [46591] (1 species) |
| Species Thermus thermophilus, strain hb27 [TaxId:274] [46592] (4 PDB entries) |
| Domain d1sryb1: 1sry B:1-110 [15707] Other proteins in same PDB: d1srya2, d1sryb2 |
PDB Entry: 1sry (more details), 2.5 Å
SCOPe Domain Sequences for d1sryb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sryb1 a.2.7.1 (B:1-110) Seryl-tRNA synthetase (SerRS) {Thermus thermophilus, strain hb27 [TaxId: 274]}
mvdlkrlrqepevfhrairekgvaldleallaldrevqelkkrlqevqternqvakrvpk
appeekealiargkalgeeakrleealrekearlealllqvplppwpgap
Timeline for d1sryb1: