Lineage for d3cwtd1 (3cwt D:100-281)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2334077Fold a.96: DNA-glycosylase [48149] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2334078Superfamily a.96.1: DNA-glycosylase [48150] (7 families) (S)
  5. 2334119Family a.96.1.3: DNA repair glycosylase, 2 C-terminal domains [48157] (3 proteins)
  6. 2334120Protein 3-Methyladenine DNA glycosylase II (gene alkA or aidA) [48158] (1 species)
  7. 2334121Species Escherichia coli [TaxId:562] [48159] (11 PDB entries)
    Uniprot P04395
  8. 2334137Domain d3cwtd1: 3cwt D:100-281 [157066]
    Other proteins in same PDB: d3cwta2, d3cwtb2, d3cwtc2, d3cwtd2
    automated match to d1mpga1
    protein/DNA complex

Details for d3cwtd1

PDB Entry: 3cwt (more details), 2.3 Å

PDB Description: crystal structure of an alka host/guest complex 2'-fluoro-2'- deoxyinosine:adenine base pair
PDB Compounds: (D:) DNA-3-methyladenine glycosylase 2

SCOPe Domain Sequences for d3cwtd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cwtd1 a.96.1.3 (D:100-281) 3-Methyladenine DNA glycosylase II (gene alkA or aidA) {Escherichia coli [TaxId: 562]}
aarpglrlpgcvdafeqgvrailgqlvsvamaakltarvaqlygerlddfpeyicfptpq
rlaaadpqalkalgmplkraealihlanaalegtlpmtipgdveqamktlqtfpgigrwt
anyfalrgwqakdvflpddylikqrfpgmtpaqirryaerwkpwrsyallhiwytegwqp
de

SCOPe Domain Coordinates for d3cwtd1:

Click to download the PDB-style file with coordinates for d3cwtd1.
(The format of our PDB-style files is described here.)

Timeline for d3cwtd1: