Lineage for d1srya1 (1sry A:1-110)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1077399Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1077568Superfamily a.2.7: tRNA-binding arm [46589] (4 families) (S)
    formerly a class II aminoacyl-tRNA synthetase N-domain
  5. 1077569Family a.2.7.1: Seryl-tRNA synthetase (SerRS) [46590] (1 protein)
  6. 1077570Protein Seryl-tRNA synthetase (SerRS) [46591] (1 species)
  7. 1077571Species Thermus thermophilus, strain hb27 [TaxId:274] [46592] (4 PDB entries)
  8. 1077574Domain d1srya1: 1sry A:1-110 [15706]
    Other proteins in same PDB: d1srya2, d1sryb2

Details for d1srya1

PDB Entry: 1sry (more details), 2.5 Å

PDB Description: refined crystal structure of the seryl-trna synthetase from thermus thermophilus at 2.5 angstroms resolution
PDB Compounds: (A:) SERYL-tRNA SYNTHETASE

SCOPe Domain Sequences for d1srya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1srya1 a.2.7.1 (A:1-110) Seryl-tRNA synthetase (SerRS) {Thermus thermophilus, strain hb27 [TaxId: 274]}
mvdlkrlrqepevfhrairekgvaldleallaldrevqelkkrlqevqternqvakrvpk
appeekealiargkalgeeakrleealrekearlealllqvplppwpgap

SCOPe Domain Coordinates for d1srya1:

Click to download the PDB-style file with coordinates for d1srya1.
(The format of our PDB-style files is described here.)

Timeline for d1srya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1srya2