Lineage for d3cwsb2 (3cws B:1-99)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2214642Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2214643Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families) (S)
  5. 2214755Family d.129.1.2: DNA repair glycosylase, N-terminal domain [55952] (3 proteins)
    contains a single copy of this fold
  6. 2214756Protein 3-Methyladenine DNA glycosylase II (gene alkA or aidA) [55953] (1 species)
  7. 2214757Species Escherichia coli [TaxId:562] [55954] (11 PDB entries)
    Uniprot P04395
  8. 2214765Domain d3cwsb2: 3cws B:1-99 [157055]
    Other proteins in same PDB: d3cwsa1, d3cwsb1, d3cwsc1, d3cwsd1
    automated match to d1mpga2
    protein/DNA complex

Details for d3cwsb2

PDB Entry: 3cws (more details), 2.3 Å

PDB Description: crystal structure of an alka host/guest complex 2'-fluoro-2'- deoxyinosine:thymine base pair
PDB Compounds: (B:) DNA-3-methyladenine glycosylase 2

SCOPe Domain Sequences for d3cwsb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cwsb2 d.129.1.2 (B:1-99) 3-Methyladenine DNA glycosylase II (gene alkA or aidA) {Escherichia coli [TaxId: 562]}
mytlnwqppydwswmlgflaaravssvetvadsyyarslavgeyrgvvtaipdiarhtlh
inlsaglepvaaeclakmsrlfdlqcnpqivngalgrlg

SCOPe Domain Coordinates for d3cwsb2:

Click to download the PDB-style file with coordinates for d3cwsb2.
(The format of our PDB-style files is described here.)

Timeline for d3cwsb2: