Lineage for d3cwsb1 (3cws B:100-282)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 919960Fold a.96: DNA-glycosylase [48149] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 919961Superfamily a.96.1: DNA-glycosylase [48150] (7 families) (S)
  5. 919998Family a.96.1.3: DNA repair glycosylase, 2 C-terminal domains [48157] (2 proteins)
  6. 919999Protein 3-Methyladenine DNA glycosylase II (gene alkA or aidA) [48158] (1 species)
  7. 920000Species Escherichia coli [TaxId:562] [48159] (11 PDB entries)
    Uniprot P04395
  8. 920008Domain d3cwsb1: 3cws B:100-282 [157054]
    Other proteins in same PDB: d3cwsa2, d3cwsb2, d3cwsc2, d3cwsd2
    automatically matched to d1diza1
    protein/DNA complex

Details for d3cwsb1

PDB Entry: 3cws (more details), 2.3 Å

PDB Description: crystal structure of an alka host/guest complex 2'-fluoro-2'- deoxyinosine:thymine base pair
PDB Compounds: (B:) DNA-3-methyladenine glycosylase 2

SCOPe Domain Sequences for d3cwsb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cwsb1 a.96.1.3 (B:100-282) 3-Methyladenine DNA glycosylase II (gene alkA or aidA) {Escherichia coli [TaxId: 562]}
aarpglrlpgcvdafeqgvrailgqlvsvamaakltarvaqlygerlddfpeyicfptpq
rlaaadpqalkalgmplkraealihlanaalegtlpmtipgdveqamktlqtfpgigrwt
anyfalrgwqakdvflpddylikqrfpgmtpaqirryaerwkpwrsyallhiwytegwqp
dea

SCOPe Domain Coordinates for d3cwsb1:

Click to download the PDB-style file with coordinates for d3cwsb1.
(The format of our PDB-style files is described here.)

Timeline for d3cwsb1: