Lineage for d3cwha1 (3cwh A:2-388)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 818659Superfamily c.1.15: Xylose isomerase-like [51658] (7 families) (S)
    different families share similar but non-identical metal-binding sites
  5. 818682Family c.1.15.3: Xylose isomerase [51665] (1 protein)
  6. 818683Protein D-xylose isomerase [51666] (12 species)
  7. 818811Species Streptomyces rubiginosus [TaxId:1929] [51670] (24 PDB entries)
  8. 818836Domain d3cwha1: 3cwh A:2-388 [157051]
    automatically matched to d1mnza_
    complexed with mg, oh, xul

Details for d3cwha1

PDB Entry: 3cwh (more details), 2.2 Å

PDB Description: D-xylose Isomerase in complex with linear product, per-deuterated xylulose
PDB Compounds: (A:) xylose isomerase

SCOP Domain Sequences for d3cwha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cwha1 c.1.15.3 (A:2-388) D-xylose isomerase {Streptomyces rubiginosus [TaxId: 1929]}
nyqptpedrftfglwtvgwqgrdpfgdatrraldpvesvrrlaelgahgvtfhdddlipf
gssdsereehvkrfrqalddtgmkvpmattnlfthpvfkdggftandrdvrryalrktir
nidlavelgaetyvawggregaesggakdvrdaldrmkeafdllgeyvtsqgydirfaie
pkpneprgdillptvghalafierlerpelygvnpevgheqmaglnfphgiaqalwagkl
fhidlngqngikydqdlrfgagdlraafwlvdllesagysgprhfdfkpprtedfdgvwa
saagcmrnylilkeraaafradpevqealrasrldelarptaadglqallddrsafeefd
vdaaaargmaferldqlamdhllgarg

SCOP Domain Coordinates for d3cwha1:

Click to download the PDB-style file with coordinates for d3cwha1.
(The format of our PDB-style files is described here.)

Timeline for d3cwha1: