SCOPe 2.05: Domain d3cwbc2: 3cwb C:2-261

Lineage for d3cwbc2 (3cwb C:2-261)

1. Root: SCOPe 2.05

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
   core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices

4. Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families)
   Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically

5. Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (3 proteins)
   a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria

6. Protein Mitochondrial cytochrome b subunit, N-terminal domain [81641] (3 species)
   also includes extra transmembrane (linker) helix absent in plants and cyanobacteria subunits

7. Species Chicken (Gallus gallus) [TaxId:9031] [81639] (8 PDB entries)

8. Domain d3cwbc2: 3cwb C:2-261 [157046]
   Other proteins in same PDB: d3cwbc1, d3cwbp1
   automatically matched to d1bccc3
   complexed with azi, bog, cdl, fes, hec, hem, icx, pee, unl, uq

Details for d3cwbc2

PDB Entry: 3cwb, 3.51 Å

PDB Description: chicken cytochrome bc1 complex inhibited by an iodinated analogue of the polyketide crocacin-d

PDB Compounds: (C:) cytochrome b

SCOPe Domain Sequences for d3cwbc2:

Sequence; same for both SEQRES and ATOM records:

>d3cwbc2 f.21.1.2 (C:2-261) Mitochondrial cytochrome b subunit, N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
apnirkshpllkminnslidlpapsnisawwnfgsllavclmtqiltglllamhytadts
lafssvahtcrnvqygwlirnlhangasffficiflhigrglyygsylyketwntgvill
ltlmatafvgyvlpwgqmsfwgatvitnlfsaipyightlvewawggfsvdnptltrffa
lhfllpfaiagitiihltflhesgsnnplgissdsdkipfhpyysfkdilgltlmltpfl
tlalfspnllgdpenftpan

Timeline for d3cwbc2:

• d3cwbc2 first appeared in SCOP 1.75
  
• d3cwbc2 appears in SCOPe 2.04
  
• d3cwbc2 appears in SCOPe 2.06
  
• d3cwbc2 appears in the current release, SCOPe 2.08