Lineage for d1fxkb_ (1fxk B:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 811Fold a.2: Long alpha-hairpin [46556] (11 superfamilies)
  4. 845Superfamily a.2.5: Prefoldin [46579] (1 family) (S)
  5. 846Family a.2.5.1: Prefoldin [46580] (2 proteins)
  6. 850Protein Prefoldin beta subunit [46583] (1 species)
  7. 851Species Archaea (Methanobacterium thermoautotrophicum) [TaxId:145262] [46584] (1 PDB entry)
  8. 853Domain d1fxkb_: 1fxk B: [15704]
    Other proteins in same PDB: d1fxkc_

Details for d1fxkb_

PDB Entry: 1fxk (more details), 2.3 Å

PDB Description: crystal structure of archaeal prefoldin (gimc).

SCOP Domain Sequences for d1fxkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fxkb_ a.2.5.1 (B:) Prefoldin beta subunit {Archaea (Methanobacterium thermoautotrophicum)}
nvqhqlaqfqqlqqqaqaisvqkqtvemqinetqkaleelsraaddaevykssgnilirv
akdelteelqekletlqlrektierqeervmkklqemqvniqeamkgag

SCOP Domain Coordinates for d1fxkb_:

Click to download the PDB-style file with coordinates for d1fxkb_.
(The format of our PDB-style files is described here.)

Timeline for d1fxkb_: