![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
![]() | Superfamily a.2.5: Prefoldin [46579] (1 family) ![]() |
![]() | Family a.2.5.1: Prefoldin [46580] (2 proteins) contains one or two beta-hairpins at the tip of alpha-hairpin |
![]() | Protein Prefoldin beta subunit [46583] (1 species) |
![]() | Species Methanobacterium thermoautotrophicum [TaxId:145262] [46584] (1 PDB entry) |
![]() | Domain d1fxkb_: 1fxk B: [15704] Other proteins in same PDB: d1fxkc_ |
PDB Entry: 1fxk (more details), 2.3 Å
SCOPe Domain Sequences for d1fxkb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fxkb_ a.2.5.1 (B:) Prefoldin beta subunit {Methanobacterium thermoautotrophicum [TaxId: 145262]} nvqhqlaqfqqlqqqaqaisvqkqtvemqinetqkaleelsraaddaevykssgnilirv akdelteelqekletlqlrektierqeervmkklqemqvniqeamkgag
Timeline for d1fxkb_: