SCOP 1.75: Domain d3cwaa1: 3cwa A:100-282

Lineage for d3cwaa1 (3cwa A:100-282)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.96: DNA-glycosylase [48149] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.96.1: DNA-glycosylase [48150] (6 families)

5. Family a.96.1.3: DNA repair glycosylase, 2 C-terminal domains [48157] (2 proteins)

6. Protein 3-Methyladenine DNA glycosylase II (gene alkA or aidA) [48158] (1 species)

7. Species Escherichia coli [TaxId:562] [48159] (11 PDB entries)
   Uniprot P04395

8. Domain d3cwaa1: 3cwa A:100-282 [157037]
   Other proteins in same PDB: d3cwaa2, d3cwab2, d3cwac2, d3cwad2
   automatically matched to d1diza1
   complexed with 8og

Details for d3cwaa1

PDB Entry: 3cwa, 2.4 Å

PDB Description: crystal structure of an alka host/guest complex 8oxoguanine:cytosine base pair

PDB Compounds: (A:) DNA-3-methyladenine glycosylase 2

SCOP Domain Sequences for d3cwaa1:

Sequence; same for both SEQRES and ATOM records:

>d3cwaa1 a.96.1.3 (A:100-282) 3-Methyladenine DNA glycosylase II (gene alkA or aidA) {Escherichia coli [TaxId: 562]}
aarpglrlpgcvdafeqgvrailgqlvsvamaakltarvaqlygerlddfpeyicfptpq
rlaaadpqalkalgmplkraealihlanaalegtlpmtipgdveqamktlqtfpgigrwt
anyfalrgwqakdvflpddylikqrfpgmtpaqirryaerwkpwrsyallhiwytegwqp
dea

Timeline for d3cwaa1:

• d3cwaa1 is new in SCOP 1.75
  
• d3cwaa1 appears in SCOPe 2.01
  
• d3cwaa1 appears in the current release, SCOPe 2.08