Lineage for d3cw7c1 (3cw7 C:100-282)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2720979Fold a.96: DNA-glycosylase [48149] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2720980Superfamily a.96.1: DNA-glycosylase [48150] (7 families) (S)
  5. 2721021Family a.96.1.3: DNA repair glycosylase, 2 C-terminal domains [48157] (3 proteins)
  6. 2721022Protein 3-Methyladenine DNA glycosylase II (gene alkA or aidA) [48158] (1 species)
  7. 2721023Species Escherichia coli [TaxId:562] [48159] (11 PDB entries)
    Uniprot P04395
  8. 2721030Domain d3cw7c1: 3cw7 C:100-282 [157031]
    Other proteins in same PDB: d3cw7a2, d3cw7b2, d3cw7c2, d3cw7d2
    automated match to d1mpga1
    protein/DNA complex

Details for d3cw7c1

PDB Entry: 3cw7 (more details), 2.3 Å

PDB Description: crystal structure of an alka host/guest complex 8oxoguanine:cytosine base pair
PDB Compounds: (C:) DNA-3-methyladenine glycosylase 2

SCOPe Domain Sequences for d3cw7c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cw7c1 a.96.1.3 (C:100-282) 3-Methyladenine DNA glycosylase II (gene alkA or aidA) {Escherichia coli [TaxId: 562]}
aarpglrlpgcvdafeqgvrailgqlvsvamaakltarvaqlygerlddfpeyicfptpq
rlaaadpqalkalgmplkraealihlanaalegtlpmtipgdveqamktlqtfpgigrwt
anyfalrgwqakdvflpddylikqrfpgmtpaqirryaerwkpwrsyallhiwytegwqp
dea

SCOPe Domain Coordinates for d3cw7c1:

Click to download the PDB-style file with coordinates for d3cw7c1.
(The format of our PDB-style files is described here.)

Timeline for d3cw7c1: