SCOPe 2.05: Domain d3cw7a2: 3cw7 A:1-99

Lineage for d3cw7a2 (3cw7 A:1-99)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families)

5. Family d.129.1.2: DNA repair glycosylase, N-terminal domain [55952] (2 proteins)
   contains a single copy of this fold

6. Protein 3-Methyladenine DNA glycosylase II (gene alkA or aidA) [55953] (1 species)

7. Species Escherichia coli [TaxId:562] [55954] (11 PDB entries)
   Uniprot P04395

8. Domain d3cw7a2: 3cw7 A:1-99 [157028]
   Other proteins in same PDB: d3cw7a1, d3cw7b1, d3cw7c1, d3cw7d1
   automated match to d1mpga2
   protein/DNA complex

Details for d3cw7a2

PDB Entry: 3cw7, 2.3 Å

PDB Description: crystal structure of an alka host/guest complex 8oxoguanine:cytosine base pair

PDB Compounds: (A:) DNA-3-methyladenine glycosylase 2

SCOPe Domain Sequences for d3cw7a2:

Sequence; same for both SEQRES and ATOM records:

>d3cw7a2 d.129.1.2 (A:1-99) 3-Methyladenine DNA glycosylase II (gene alkA or aidA) {Escherichia coli [TaxId: 562]}
mytlnwqppydwswmlgflaaravssvetvadsyyarslavgeyrgvvtaipdiarhtlh
inlsaglepvaaeclakmsrlfdlqcnpqivngalgrlg

Timeline for d3cw7a2:

• d3cw7a2 first appeared in SCOP 1.75
  
• d3cw7a2 appears in SCOPe 2.04
  
• d3cw7a2 appears in SCOPe 2.06
  
• d3cw7a2 appears in the current release, SCOPe 2.08