Lineage for d3cw7a1 (3cw7 A:100-282)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1742126Fold a.96: DNA-glycosylase [48149] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 1742127Superfamily a.96.1: DNA-glycosylase [48150] (7 families) (S)
  5. 1742167Family a.96.1.3: DNA repair glycosylase, 2 C-terminal domains [48157] (3 proteins)
  6. 1742168Protein 3-Methyladenine DNA glycosylase II (gene alkA or aidA) [48158] (1 species)
  7. 1742169Species Escherichia coli [TaxId:562] [48159] (11 PDB entries)
    Uniprot P04395
  8. 1742172Domain d3cw7a1: 3cw7 A:100-282 [157027]
    Other proteins in same PDB: d3cw7a2, d3cw7b2, d3cw7c2, d3cw7d2
    automated match to d1mpga1
    protein/DNA complex

Details for d3cw7a1

PDB Entry: 3cw7 (more details), 2.3 Å

PDB Description: crystal structure of an alka host/guest complex 8oxoguanine:cytosine base pair
PDB Compounds: (A:) DNA-3-methyladenine glycosylase 2

SCOPe Domain Sequences for d3cw7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cw7a1 a.96.1.3 (A:100-282) 3-Methyladenine DNA glycosylase II (gene alkA or aidA) {Escherichia coli [TaxId: 562]}
aarpglrlpgcvdafeqgvrailgqlvsvamaakltarvaqlygerlddfpeyicfptpq
rlaaadpqalkalgmplkraealihlanaalegtlpmtipgdveqamktlqtfpgigrwt
anyfalrgwqakdvflpddylikqrfpgmtpaqirryaerwkpwrsyallhiwytegwqp
dea

SCOPe Domain Coordinates for d3cw7a1:

Click to download the PDB-style file with coordinates for d3cw7a1.
(The format of our PDB-style files is described here.)

Timeline for d3cw7a1: