Lineage for d3cvtd2 (3cvt D:1-99)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 872515Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 872516Superfamily d.129.1: TATA-box binding protein-like [55945] (2 families) (S)
  5. 872628Family d.129.1.2: DNA repair glycosylase, N-terminal domain [55952] (2 proteins)
    contains a single copy of this fold
  6. 872629Protein 3-Methyladenine DNA glycosylase II (gene alkA or aidA) [55953] (1 species)
  7. 872630Species Escherichia coli [TaxId:562] [55954] (11 PDB entries)
    Uniprot P04395
  8. 872658Domain d3cvtd2: 3cvt D:1-99 [157026]
    Other proteins in same PDB: d3cvta1, d3cvtb1, d3cvtc1, d3cvtd1
    automatically matched to d1diza2
    complexed with 8og

Details for d3cvtd2

PDB Entry: 3cvt (more details), 2.5 Å

PDB Description: crystal structure of an alka host/guest complex 8oxoguanine:cytosine base pair
PDB Compounds: (D:) DNA-3-methyladenine glycosylase 2

SCOP Domain Sequences for d3cvtd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cvtd2 d.129.1.2 (D:1-99) 3-Methyladenine DNA glycosylase II (gene alkA or aidA) {Escherichia coli [TaxId: 562]}
mytlnwqppydwswmlgflaaravssvetvadsyyarslavgeyrgvvtaipdiarhtlh
inlsaglepvaaeclakmsrlfdlqcnpqivngalgrlg

SCOP Domain Coordinates for d3cvtd2:

Click to download the PDB-style file with coordinates for d3cvtd2.
(The format of our PDB-style files is described here.)

Timeline for d3cvtd2: