Lineage for d3cvtc1 (3cvt C:100-282)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 773729Fold a.96: DNA-glycosylase [48149] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 773730Superfamily a.96.1: DNA-glycosylase [48150] (6 families) (S)
  5. 773764Family a.96.1.3: DNA repair glycosylase, 2 C-terminal domains [48157] (2 proteins)
  6. 773765Protein 3-Methyladenine DNA glycosylase II (gene alkA or aidA) [48158] (1 species)
  7. 773766Species Escherichia coli [TaxId:562] [48159] (11 PDB entries)
    Uniprot P04395
  8. 773793Domain d3cvtc1: 3cvt C:100-282 [157023]
    Other proteins in same PDB: d3cvta2, d3cvtb2, d3cvtc2, d3cvtd2
    automatically matched to d1diza1
    complexed with 8og

Details for d3cvtc1

PDB Entry: 3cvt (more details), 2.5 Å

PDB Description: crystal structure of an alka host/guest complex 8oxoguanine:cytosine base pair
PDB Compounds: (C:) DNA-3-methyladenine glycosylase 2

SCOP Domain Sequences for d3cvtc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cvtc1 a.96.1.3 (C:100-282) 3-Methyladenine DNA glycosylase II (gene alkA or aidA) {Escherichia coli [TaxId: 562]}
aarpglrlpgcvdafeqgvrailgqlvsvamaakltarvaqlygerlddfpeyicfptpq
rlaaadpqalkalgmplkraealihlanaalegtlpmtipgdveqamktlqtfpgigrwt
anyfalrgwqakdvflpddylikqrfpgmtpaqirryaerwkpwrsyallhiwytegwqp
dea

SCOP Domain Coordinates for d3cvtc1:

Click to download the PDB-style file with coordinates for d3cvtc1.
(The format of our PDB-style files is described here.)

Timeline for d3cvtc1: