Lineage for d1fxkc_ (1fxk C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2302754Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2302940Superfamily a.2.5: Prefoldin [46579] (1 family) (S)
  5. 2302941Family a.2.5.1: Prefoldin [46580] (2 protein domains)
    contains one or two beta-hairpins at the tip of alpha-hairpin
  6. 2302942Protein Prefoldin alpha subunit [46581] (1 species)
  7. 2302943Species Methanobacterium thermoautotrophicum [TaxId:145262] [46582] (1 PDB entry)
  8. 2302944Domain d1fxkc_: 1fxk C: [15702]
    Other proteins in same PDB: d1fxka_, d1fxkb_

Details for d1fxkc_

PDB Entry: 1fxk (more details), 2.3 Å

PDB Description: crystal structure of archaeal prefoldin (gimc).
PDB Compounds: (C:) protein (prefoldin)

SCOPe Domain Sequences for d1fxkc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fxkc_ a.2.5.1 (C:) Prefoldin alpha subunit {Methanobacterium thermoautotrophicum [TaxId: 145262]}
aalaeivaqlniyqsqveliqqqmeavratiseleilektlsdiqgkdgsetlvpvgags
fikaelkdtsevimsvgagvaikknfedamesiksqknelestlqkmgenlraitdimmk
lspqaeellaava

SCOPe Domain Coordinates for d1fxkc_:

Click to download the PDB-style file with coordinates for d1fxkc_.
(The format of our PDB-style files is described here.)

Timeline for d1fxkc_: