| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.5: Prefoldin [46579] (1 family) ![]() |
| Family a.2.5.1: Prefoldin [46580] (2 proteins) contains one or two beta-hairpins at the tip of alpha-hairpin |
| Protein Prefoldin alpha subunit [46581] (1 species) |
| Species Methanobacterium thermoautotrophicum [TaxId:145262] [46582] (1 PDB entry) |
| Domain d1fxkc_: 1fxk C: [15702] Other proteins in same PDB: d1fxka_, d1fxkb_ |
PDB Entry: 1fxk (more details), 2.3 Å
SCOPe Domain Sequences for d1fxkc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fxkc_ a.2.5.1 (C:) Prefoldin alpha subunit {Methanobacterium thermoautotrophicum [TaxId: 145262]}
aalaeivaqlniyqsqveliqqqmeavratiseleilektlsdiqgkdgsetlvpvgags
fikaelkdtsevimsvgagvaikknfedamesiksqknelestlqkmgenlraitdimmk
lspqaeellaava
Timeline for d1fxkc_: