Lineage for d3cvih_ (3cvi H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (23 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (610 PDB entries)
  8. 2744240Domain d3cvih_: 3cvi H: [157010]
    Other proteins in same PDB: d3cvil1, d3cvil2
    automated match to d6shgh_

Details for d3cvih_

PDB Entry: 3cvi (more details), 1.8 Å

PDB Description: How TCR-like antibody recognizes MHC-bound peptide
PDB Compounds: (H:) 25-D1.16 Heavy chain

SCOPe Domain Sequences for d3cvih_:

Sequence, based on SEQRES records: (download)

>d3cvih_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vllqqsgpelvkpgasvkipckasgytftdynmdwvkqshgkslewigdinpnnggtiyn
qkfkgkatltvdksssaaymevrsltsedtavyycarkpyygnfawfaywgqgtlvtvsa
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivp

Sequence, based on observed residues (ATOM records): (download)

>d3cvih_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vllqqsgpelvkpgasvkipckasgytftdynmdwvkqshgkslewigdinpnnggtiyn
qkfkgkatltvdksssaaymevrsltsedtavyycarkpyygnfawfaywgqgtlvtvsa
akttppsvyplapgsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlss
svtvpsstwpsetvtcnvahpasstkvdkkivp

SCOPe Domain Coordinates for d3cvih_:

Click to download the PDB-style file with coordinates for d3cvih_.
(The format of our PDB-style files is described here.)

Timeline for d3cvih_: