Lineage for d1du2a_ (1du2 A:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 44819Fold a.2: Long alpha-hairpin [46556] (11 superfamilies)
  4. 44849Superfamily a.2.4: Theta subunit of DNA polymerase III [46575] (1 family) (S)
  5. 44850Family a.2.4.1: Theta subunit of DNA polymerase III [46576] (1 protein)
  6. 44851Protein Theta subunit of DNA polymerase III [46577] (1 species)
  7. 44852Species Escherichia coli [TaxId:562] [46578] (1 PDB entry)
  8. 44853Domain d1du2a_: 1du2 A: [15701]

Details for d1du2a_

PDB Entry: 1du2 (more details)

PDB Description: solution structure of the theta subunit of dna polymerase iii

SCOP Domain Sequences for d1du2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1du2a_ a.2.4.1 (A:) Theta subunit of DNA polymerase III {Escherichia coli}
mlknlakldqtemdkvnvdlaaagvafkerynmpviaeavereqpehlrswfrerliahr
lasvnlsrlpyepklk

SCOP Domain Coordinates for d1du2a_:

Click to download the PDB-style file with coordinates for d1du2a_.
(The format of our PDB-style files is described here.)

Timeline for d1du2a_: