Lineage for d3cvha2 (3cvh A:1-181)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1405985Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1405986Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1405987Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1406058Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species)
  7. 1406441Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (41 PDB entries)
    Uniprot P01901 22-299
  8. 1406480Domain d3cvha2: 3cvh A:1-181 [157003]
    Other proteins in same PDB: d3cvha1, d3cvhb_, d3cvhh1, d3cvhl1, d3cvhl2, d3cvhm1, d3cvhn_, d3cvhq1, d3cvhr1, d3cvhr2
    automated match to d1lk2a2

Details for d3cvha2

PDB Entry: 3cvh (more details), 2.9 Å

PDB Description: how tcr-like antibody recognizes mhc-bound peptide
PDB Compounds: (A:) h-2 class I histocompatibility antigen, k-b alpha chain

SCOPe Domain Sequences for d3cvha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cvha2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB [TaxId: 10090]}
gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
r

SCOPe Domain Coordinates for d3cvha2:

Click to download the PDB-style file with coordinates for d3cvha2.
(The format of our PDB-style files is described here.)

Timeline for d3cvha2: